PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00094627001
Common NameGSBRNA2T00094627001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 341aa    MW: 36608.5 Da    PI: 8.0034
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00094627001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.43.8e-3970129362
               zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++ +kcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk s
  GSBRNA2T00094627001  70 DHPQKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKPS 129
                          6789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-3460123IPR003851Zinc finger, Dof-type
PfamPF027011.0E-3271127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.76173127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGLTSLQACM DSDWLQEAES SGGSMLDSTT TSPSAADILA ACSTRPQASA MAVAAAAMMD  60
GGRRLRPPHD HPQKCPRCES THTKFCYYNN YSLSQPRYFC KTCRRYWTKG GTLRNIPVGG  120
GCRKNKKPSS SNSPSSKKPN IVTSDLMALA HSHQNYQNAS LGFQHFGGNG MMGSYTAPDH  180
SNVGYLESKY GGLLSQSPRP IDFLDSKFDL MGVNNNNLVM VDHGSNGDHH HNLHNNVGGG  240
GLMDISACQR LMLSNYDHHH YNHHEDNQRV TSIMDVKPSP KLLSLDWQQE QGYSEGSGNG  300
GGGRSDGGGY GGGGYINGLG SSWNGLMNGY GSSTKTNSLV *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1301308GGRSDGGG
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00094627001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2289921e-165AK228992.1 Arabidopsis thaliana mRNA for Dof zinc finger protein - like, complete cds, clone: RAFL16-29-O12.
GenBankBT0204671e-165BT020467.1 Arabidopsis thaliana At5g62940 gene, complete cds.
GenBankBT0205761e-165BT020576.1 Arabidopsis thaliana At5g62940 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013661196.10.0PREDICTED: dof zinc finger protein DOF5.6-like
RefseqXP_013661194.10.0PREDICTED: dof zinc finger protein DOF5.6-like
SwissprotQ9FM031e-166DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBLA0A078FUN80.0A0A078FUN8_BRANA; BnaA09g06280D protein
STRINGBra035873.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-142Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]